LG Energy Solution Patente
🇰🇷 Südkorea
Südkoreanisches Unternehmen der LG-Gruppe, das Lithium-Ionen-Batterien und Batteriesysteme entwickelt und herstellt, insbesondere für Elektrofahrzeuge, Energiespeicher sowie mobile und portable Elektronikgeräte.
Patente nach Anmeldejahr
Nach Anmeldejahr. Patentanmeldungen werden in der Regel erst 18 Monate nach der Anmeldung veröffentlicht, daher sind die jüngsten Jahre noch unvollständig. Der graue Balkenanteil zeigt eine Hochrechnung auf Basis der typischen Veröffentlichungsverzögerung.
Patente durchsuchen
2.226 gesamt| Patent | |||
|---|---|---|---|
|
23.04.2026
Verfahren zur Erzeugung einer Rezeptur zum Laden mit Mehrstufigem Konstantem Strom (mscc) und Verfahren zur Herstellung einer Sekundärbatterie damit
|
|||
|
Zusammenfassung
According to exemplary embodiments, a method for generating a recipe for MSCC (Multi-Step Constant Current) charging is provided. The method includes: charging a modeling cell to collect charging data of the modeling cell; deriving a current-capacitance model based on the charging data; and generating a recipe for MSCC (Multi-Step Constant Current) charging based on the current-capacitance model. |
|||
|
16.04.2026
Batteriediagnosevorrichtung und Verfahren dafür
|
|||
|
Status
Angemeldet am 15.09.2025
Anhängig
Vertretung
Plasseraud IP
Zusammenfassung
This document relates to a battery diagnosis device including a memory configured to store at least one instruction and a processor configured to execute the at least one instruction, in which the processor may be configured to acquire temperature data of a battery unit and estimate, based on the temperature data, a temperature of the battery unit in a blank period in which no temperature value exists within a time period corresponding to the temperature data. |
|||
|
16.04.2026
Stromabnehmerplattenschweissvorrichtung für Batterie und Stromabnehmerplattenschweissverfahren damit
|
|||
|
Zusammenfassung
A current collector plate welding device for a battery for welding a current collector plate to an electrode assembly according to one embodiment of the present invention comprises: a welding mask comprising an alignment pin arranged to protrude on one side; and a current collector plate carrier on which the current collector plate is disposed and comprising an alignment groove into which the alignment pin is inserted.The current collector plate welding device for a battery and the current collector plate welding method according to an embodiment of the present invention have the effect of improving the welding quality of the current collector plate by ensuring concentricity between the current collector plate carrier and the welding mask. |
|||
|
16.04.2026
Batterieverwaltungsvorrichtung und Batterieverwaltungsverfahren
|
|||
|
Zusammenfassung
According to an embodiment disclosed in this document, there is provided a battery management device including an interface configured to acquire a voltage profile representing a voltage relative to a capacity of a battery cell and at least one processor, in which the at least one processor is configured to identify at least one inflection point based on the voltage profile, identify a capacity of silicon contained in the battery cell using the at least one inflection point, and control charging or discharging of the battery cell based on the capacity of silicon. |
|||
|
16.04.2026
Datenanalysevorrichtung und Verfahren dafür
|
|||
|
Zusammenfassung
A data analysis device according to an embodiment of the present disclosure may include a memory configured to store at least one instruction and at least one processor configured to execute the at least one instruction, and the at least one processor may acquire a set of data of a battery cell and a time interval at which data included in the set of data is acquired, identify a plurality of data regions including at least one of a plurality of first ranges for dividing a first state variable of the battery cell by a first magnitude, a plurality of second ranges for dividing a second state variable of the battery cell by a second magnitude, or any combination thereof, and diagnose a state of the battery cell based on battery data regions including the set of data among the plurality of data regions and a time that is identified according to the time interval and in which the data is included in each of the battery data regions. |
|||
|
16.04.2026
Batteriemodul und Batteriepack sowie Fahrzeug damit
|
|||
|
Zusammenfassung
To achieve the above object, a battery module according to an exemplary embodiment of the present disclosure may include a cell frame configured to accommodate a battery cell; a bracket mounted on the cell frame; a fixing member mounted to the bracket and configured to secure a wire harness arranged above the bracket; and a fastening member configured to fasten the cell frame and the bracket. |
|||
|
16.04.2026
Saugvorrichtung und Laschenkerbungsvorrichtung damit
|
|||
|
Zusammenfassung
A tab notching apparatus according to the present disclosure includes a suction pipe having a suction hole through which a residual scrap moves, the residual scrap being formed in forming an electrode tab, and a cutting device configured to cut the residual scrap moving toward the suction hole, wherein the cutting device includes a cutter configured to slidably move. |
|||
|
16.04.2026
Beutelartige Batteriezelle, Vorrichtung zum Rollen des Dichtungsabschnitts einer Beutelartigen Batteriezelle und Verfahren zum Rollen des Dichtungsabschnitts damit
|
|||
|
Zusammenfassung
Disclosed are a pouch-shaped battery cell including an electrode assembly in which a positive electrode and a negative electrode are stacked with a separator interposed therebetween and a pouch-shaped battery case having an electrode assembly receiving portion configured to receive the electrode assembly, wherein the pouch-shaped battery case includes a first case and a second case, the first case and the second case are coupled to each other such that outer peripheries thereof are aligned with each other to form a sealed portion, and the sealed portion is a roll-shaped sealed portion wound in the shape of a roll, a sealed portion rolling apparatus for the pouch-shaped battery cell, and a sealed portion rolling method using the same. |
|||
|
16.04.2026
Vorrichtung zum Stapeln von Einzelzellen und Verfahren zum Stapeln von Einzelzellen damit
|
|||
|
Zusammenfassung
Disclosed are a unit cell stacking apparatus including a conveyor belt configured to allow a unit cell to be seated thereon and to transfer the unit cell to one side or the other side, a transfer unit configured to transfer the unit cell while suctioning an upper surface of the unit cell, an image capturing unit configured to capture an image of the unit cell, a controller configured to determine whether the unit cell is defective based on information received from the image capturing unit, a stacking unit configured to allow a normal unit cell determined to be normal by the controller to be stacked thereon, and an ejection unit configured to eject a defective unit cell determined to be defective by the controller, and a unit cell stacking method using the same. |
|||
|
16.04.2026
Lithiumsekundärbatterie
|
|||
|
Zusammenfassung
The present disclosure relates to a lithium secondary battery including a positive electrode; a negative electrode facing the positive electrode; a separator disposed between the positive electrode and the negative electrode; and a non-aqueous electrolyte, wherein the positive electrode includes a first positive electrode active material and a second positive electrode active material, the first positive electrode active material includes lithium iron phosphate represented by Formula 1, the second positive electrode active material includes lithium nickel cobalt manganese oxide, and the non-aqueous electrolyte includes a lithium salt; a first solvent; and a second solvent, wherein the first solvent is a non-fluorinated carbonate organic solvent, and the second solvent is a compound represented by Formula 2, wherein a ratio (A/B) of a weight (A) of the first solvent to a weight (B) of the second solvent may be 0.67 or less. |
|||
|
16.04.2026
Batteriegehäuse und Lithiumsekundärbatterie damit
|
|||
|
Zusammenfassung
The present disclosure relates to a battery case and a lithium secondary battery including the same. The battery case includes a metal-organic framework compound that adsorbs oxygen gas and/or hydrocarbon gas in the form of a gas adsorbent or a gas adsorbing film therein, and thus can effectively remove gas generated during operation of a secondary battery. Therefore, a lithium secondary battery including the same has excellent lifespan characteristics and safety. |
|||
|
09.04.2026
Positivelektrodenstromkollektorplatte sowie Batterie und Fahrzeug damit
|
|||
|
Zusammenfassung
Provided are a positive electrode current collector plate configured to perform a stable fusing function while reducing resistance, and a battery and a vehicle comprising the same.A battery including a jelly-roll in which a positive electrode, a negative electrode, and a separator are wound in one direction further includes a can configured to accommodate the jelly-roll, a rivet configured to be electrically connected to the jelly-roll and pass through one side of the can, and a positive electrode current collector plate disposed between the jelly-roll and the rivet and including a rivet coupling portion coupled with the rivet and a plurality of tab coupling portions provided on a radially outer side of the rivet coupling portion so as to be coupled with the jelly-roll, wherein the positive electrode current collector plate further includes a pair of slits provided on an inner side of the plurality of tab coupling portions and disposed to be spaced apart from each other so as to face each other, and a fusing bridge forming a portion of the rivet coupling portion between the pair of slits and constituting a path of current flowing from the jelly-roll to the rivet. |
|||
|
09.04.2026
Sekundärbatterie
|
|||
|
Zusammenfassung
According to exemplary embodiments, a secondary battery is provided. The secondary battery may include: a cell case including an inner space; a thermal insulation partition wall separating the inner space into a plurality of accommodating spaces; electrode assemblies accommodated in each of the accommodating spaces; and venting covers overlapping each of the accommodating spaces. Each of the venting covers may be configured to rupture when an internal pressure of each corresponding accommodating space is equal to or greater than a reference pressure. |
|||
|
09.04.2026
Batteriemodul, das Leicht in einem Packgehäuse Installiert Werden Kann, und Batteriepack damit
|
|||
|
Zusammenfassung
A battery module that is easily mountable in a pack case and a battery pack including the same are disclosed. A battery module according to an embodiment of the present disclosure includes a battery cell stack in which a plurality of battery cells are stacked, and a busbar frame on one side of the battery cell stack. The busbar frame includes a busbar electrically connected to a plurality of electrodes of the plurality of battery cells, and a plurality of through holes for fixing to a lower surface of a pack case comprising a battery pack. The plurality of through holes extend through the busbar frame from an upper surface of the busbar frame to a lower surface of the busbar frame for coupling between the busbar frame and the pack case. |
|||
|
09.04.2026
Drahtförmige Sekundärbatterie
|
|||
|
Zusammenfassung
According to exemplary embodiments, a wire-type secondary battery is provided. The wire-type secondary battery includes: a support including a core and a helical guide extending along a surface of the core; a first electrode helically wound along the surface of the core between the guides; a first separator layer provided on an outer side of the first electrode and helically wound along the first electrode; and a second electrode provided on an outer side of the first separator layer and helically wound along the first separator layer. The support includes: a first groove into which the first electrode is inserted; a second groove into which the first separator layer is inserted; and a third groove into which the second electrode is inserted. A width of the second groove is greater than a width of the first groove. |
|||
|
02.04.2026
Shimplatte, Schlitzdüsenbeschichter damit und Verfahren zur Herstellung der Shimplatte
|
|||
|
Zusammenfassung
A shim plate according to an exemplary embodiment of the present disclosure includes: a first side end portion in the shape of a plate provided on one side; a second side end portion in the shape of a plate provided on the other side; and at least one rib provided between the first side end portion and the second side end portion, arranged parallel to the first side end portion and the second side end portion, and configured to have at least one step in a longitudinal direction. |
|||
|
02.04.2026
Beutelartiges Batteriezellenpresselement, Batteriemodul damit und Beutelartiges Batteriezellenpressverfahren damit
|
|||
|
Zusammenfassung
A pouch-type battery cell pressing member includes: a first pressing part including a first base plate, a first elastic member having a first end coupled to the first base plate, and a plurality of first contact portions coupled to a second end of the first elastic member, and a second pressing part including a second base plate, a second elastic portion having a first end coupled to the second base plate, and a plurality of second contact portions coupled to a second end of the second elastic portion. The plurality of first contact portions and the plurality of second contact portions define a first region where pressing surfaces are substantially parallel to the first base plate and the second base plate, and a second region where pressing surfaces are formed in an inclined shape with respect to the first base plate and the second base plate. |
|||
|
02.04.2026
Zellenlade- und -Entladevorrichtung mit Abstandseinstellbaren Zellengreifern sowie Zellenlade- und -Entladeverfahren damit
|
|||
|
Zusammenfassung
Disclosed are a cell charging and discharging apparatus provided with distance-adjustable cell grippers and a cell charging and discharging method using the same, and more particularly a cell charging and discharging apparatus including cell grippers located spaced apart from each other by a certain distance, a distance adjustment unit configured to adjust the distance between the cell grippers, and a driving unit connected to the distance adjustment unit, the driving unit being configured to drive the distance adjustment unit, wherein the cell gripper includes a body portion, a piezoelectric element located on each of both sides of the body portion, and a connection portion configured to connect the body portion and the piezoelectric element to each other, the length of the connection portion being adjustable, and a cell charging and discharging method using the same. |
|||
|
02.04.2026
Verfahren zur Rückgewinnung von Lithium
|
|||
|
Zusammenfassung
The present invention relates to a method of recovering lithium. More particularly, the present invention relates to a method of recovering lithium, including a step of obtaining a leachate, in which a lithium component is dissolved, from cathode material powder, and a step of purifying a lithium component by introducing the leachate into a flow capacitive deionization apparatus. According to the method of the present invention, by easily removing impurities from a leachate, in which a lithium component is dissolved from cathode material powder, through an electrochemical adsorption and desorption process, high-purity lithium may be recovered, and an eco-friendly benefit may be obtained by reducing an amount of wastewater generated. In addition, by simultaneously performing the purification and filtration of lithium, the process may be simpler than a conventional process, a continuous process is possible, and processing cost and energy may be reduced. |
|||
|
02.04.2026
Beutelfolienlaminat, Beutelartiges Batteriegehäuse und Beutelartige Sekundärbatterie
|
|||
|
Zusammenfassung
The present invention relates to a pouch film laminate including a substrate layer, a gas barrier layer, and a sealant layer laminated in sequence, wherein the sealant layer includes a first sealant layer disposed adjacent to the gas barrier layer, and a second sealant layer laminated on the first sealant layer, the second sealant layer includes a polypropylene (PP)-polydimethylsiloxane (PDMS) copolymer, and the polypropylene (PP)-polydimethylsiloxane (PDMS) copolymer includes polydimethylsiloxane (PDMS) in an amount of 1 wt% to 12 wt%. |
|||
|
02.04.2026
Sammelschienenanordnung und Batteriemodul und Batteriepack damit
|
|||
|
Zusammenfassung
A busbar assembly may include a frame configured to cover one side or both sides of a battery cell stack, the battery cell stack including battery cells, in which electrode leads of the battery cells are stacked on one side of the frame, and some of the stacked electrode leads are positive electrode leads and others are negative electrode leads. |
|||
|
02.04.2026
Bandspulenzuführvorrichtung, Isolierbandzuführverfahren, Batteriepack und Fahrzeug
|
|||
|
Zusammenfassung
According to one embodiment of the present invention, a tape reel supply device for supplying an insulating tape to a conveying unit comprises a supply unit, in which a plurality of tape reel cassette units, each wound with an insulating tape, are disposed on a rotatable supply body at intervals, and the supply unit replaces and supplies the insulating tape to the conveying unit.A tape reel supply device and an insulating tape supply method according to one embodiment of the present invention have the effect of effectively replacing and supplying an insulating tape wound on a tape reel cassette unit. |
|||
|
02.04.2026
Formvorrichtung
|
|||
|
Zusammenfassung
The present disclosure relates to a forming apparatus for shaping first and second foil tabs formed at two ends of a cylindrical electrode assembly, the forming apparatus including a rail unit configured to move the electrode assembly in a direction, and a guide unit disposed on the rail unit and configured to place the electrode assembly in position, the guide unit including a first plate facing the first foil tab and moving in a direction toward or away from the first foil tab, and a first guide portion disposed on the first plate and configured to bend the first foil tab. |
|||
|
02.04.2026
Vorrichtung zur Befestigung eines Isolierbandes
|
|||
|
Zusammenfassung
According to an embodiment of the present disclosure, an insulating tape attachment device includes a supply disk, around which an insulating tape is wound such that an adhesive surface faces outward, supplying the insulating tape, a cutting disk rotating, while facing the supply disk, and cutting the insulating tape wound around and supplied from the supply disk at a preset interval, and a main disk carrying the electrode assembly and bringing the cut insulating tape supplied by the supply disk into contact with the electrode assembly to attach the insulating tape to the electrode assembly. |
|||
|
02.04.2026
Taschenartiges Aussenelement sowie Vorrichtung und Verfahren zur Formung davon
|
|||
|
Zusammenfassung
A pouch-type exterior according to an embodiment of the present disclosure may include a cup portion formed into a recessed shape; and a terrace portion connected to the cup portion. A circumference portion of the cup portion may include a concave portion that curves inwards; a first circumference portion located between a bottom portion of the cup portion and the concave portion; and a second circumference portion located between the concave portion and the terrace portion. The concave portion may curve inwards from the first circumference portion and the second circumference portion. |
|||
|
02.04.2026
Leckdetektionsvorrichtung und Batteriepack damit
|
|||
|
Zusammenfassung
Disclosed are a leakage detection device including a moisture detection unit to which an absorption member is coupled, a fixing support portion configured to fix the moisture detection unit to a battery pack, and an extension portion configured to fix the moisture detection unit to the fixing support portion, wherein a lower end of the absorption member extends at least to a lower end of the fixing support portion, and a battery pack including the same. It is possible to rapidly detect even a small amount of coolant leakage. |
|||
|
02.04.2026
System zur Herstellung einer Sekundärbatterie
|
|||
|
Zusammenfassung
According to exemplary embodiments, a secondary battery manufacturing system is provided. The system includes secondary battery manufacturing equipment; a particle sensing device installed in the secondary battery manufacturing equipment and configured to collect particle data representing size and density of particles generated from the secondary battery manufacturing equipment; a particle collecting device installed in the secondary battery manufacturing equipment and configured to collect the particles; and a particle analyzer configured to collect composition data of the particles collected by the particle collecting device. |
|||
|
19.03.2026
Batteriepack mit Selektiv Konfigurierbarer Anzahl von Entlüftungsventilen
|
|||
|
Zusammenfassung
Disclosed is a battery pack including a battery pack housing having a receiving portion configured to receive a plurality of battery modules and a cover plate coupled to an open upper surface of the battery pack housing, wherein the battery pack housing includes side walls formed in a quadrangular frame shape, a plurality of openings is formed in the side walls, and any one of a cover and a venting valve is selectively coupled to an outer surface of each of the plurality of openings. |
|||
|
19.03.2026
Anodenzusammensetzung, Anode und Sekundärbatterie
|
|||
|
Zusammenfassung
An anode composition according to an embodiment of the present invention comprises a silicon-based active material and a carbon-based active material, and simultaneously satisfies an optimal sphericity ratio represented by formula (1) and an optimal particle diameter ratio represented by formula (2). Formula (1): 0.7 ≤ X1/Y1 ≤ 1.5 Formula (2): 0.08 ≤ X2/Y2 ≤ 0.5. In formula (1), X1 denotes the sphericity of the silicon-based active material, and Y1 denotes the sphericity of the carbon-based active material, and in formula (2), X2 denotes an average particle diameter (D50) of the silicon-based active material, and Y2 denotes an average particle diameter (D50) of the carbon-based active material. |
|||
|
19.03.2026
Shimplatte und Schlitzdüsenbeschichter damit
|
|||
|
Zusammenfassung
A shim plate including a shim body and a coating layer is provided. The shim body is made of a stainless steel material. The coating layer is coated on a surface of the shim body. The shim plate is disposed between a first die block and second die block to create slot die coater with a slot defined within. |
|||
|
19.03.2026
Batteriemodul und Batteriepack damit
|
|||
|
Zusammenfassung
A battery module according to an embodiment of the present invention comprises: a battery cell stack in which a plurality of battery cells are stacked; a module case configured to accommodate the battery cell stack; and a top plate disposed on an upper side of the battery cell stack, the top plate including: a mounting hole; and a protruding wall disposed at one edge of the mounting hole and protruding upward. Thereby, the battery module according to the present embodiment can prevent bending of the top plate and loss of the wireless communication function of the cell monitoring unit. |
|||
|
19.03.2026
Kommunikationssteuerungsvorrichtung und Kommunikationssteuerungsverfahren eines Batteriesystems
|
|||
|
Zusammenfassung
A communication control method according to an embodiment of the present invention is a communication control method of a battery system control device interworking with one or more battery management systems (BMSs) and a network switch, and may comprise the steps of: monitoring a dynamic host configuration protocol (DHCP) allocation process between the network switch and each battery management device; collecting client internet protocol (IP) addresses and media access control (MAC) addresses during the monitoring; and matching and storing the IP addresses with battery management devices having MAC addresses matched with the collected MAC addresses. |
|||
|
19.03.2026
Energieanalysevorrichtung und Energieanalyseverfahren
|
|||
|
Zusammenfassung
According to some embodiments, an energy analysis device includes a processor and a memory configured to store instructions that, when executed by the processor, cause the processor to perform operations including an operation of generating meteorological interpolation data for an area of interest to which a renewable energy power plant belongs by performing data interpolation based on observed values of meteorological observation data for the area of interest, an operation of generating a power generation estimation function based on the meteorological interpolation data and past power generation data of the renewable energy power plant, and an operation of estimating an expected power generation of the renewable energy power plant based on weather forecast data for the area of interest and the power generation estimation function. |
|||
|
18.03.2026
Batteriepack
|
|||
|
Zusammenfassung
Disclosed herein relates to a battery pack for accommodating a battery module, including: a pack case in which a battery module settles; wherein the pack case includes: a main separation wall; a base plate coupled to the main separation wall and including a module area wherein the battery module is settled; and a side wall coupled along a perimeter of a base plate coupled to the main separation wall; wherein the main separation wall includes an insulating material with low thermal conductivity. |
|||
|
11.03.2026
Batteriepack mit Verbesserter Vibrationsbeständigkeit
|
|||
|
Zusammenfassung
Zusammenfassung wird geladen … |
|||
|
11.03.2026
Batteriemodul, Batteriepack und Fahrzeug
EP4708465
Halbleiter & Elektrische Bauelemente
|
|||
|
Zusammenfassung
Zusammenfassung wird geladen … |
|||
|
11.03.2026
Vorrichtung zur Herstellung einer Elektrode
|
|||
|
Zusammenfassung
Zusammenfassung wird geladen … |
|||
|
11.03.2026
Batteriegestell und Energiespeichersystem mit dem Batteriegestell
|
|||
|
Zusammenfassung
Zusammenfassung wird geladen … |
|||
|
11.03.2026
Batteriezelle und Batteriemodul damit
|
|||
|
Zusammenfassung
Zusammenfassung wird geladen … |
|||
|
11.03.2026
Batteriemodul, Batteriepack und Fahrzeug
|
|||
|
Zusammenfassung
Zusammenfassung wird geladen … |
|||
Wer vertritt LG Energy Solution?
Die Kanzleien und Patentanwälte, die LG Energy Solution vertreten, sowie alle Technologiefelder im vollständigen Anmelder-Profil.
Zum Anmelder-Profil